PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 315aa    MW: 35478.1 Da    PI: 6.6234
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19448.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.51e-152269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+lv++    G g+W+ Iar  g+ R++k+c++rw +yl
       KHN19448.1 22 KGLWSPDEDERLVRYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 69
                     678*******************************************97 PP

2Myb_DNA-binding51.52.4e-1675119147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l+v+++  lG++ W+ Ia++++ gRt++++k++w++ 
       KHN19448.1  75 RGAFSPQEEDLIVHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 119
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8641769IPR017930Myb domain
SuperFamilySSF466893.36E-2820116IPR009057Homeodomain-like
SMARTSM007172.4E-112171IPR001005SANT/Myb domain
PfamPF002498.0E-142269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-222376IPR009057Homeodomain-like
CDDcd001676.92E-102569No hitNo description
PROSITE profilePS5129425.4970124IPR017930Myb domain
SMARTSM007177.6E-1674122IPR001005SANT/Myb domain
PfamPF002496.3E-1575119IPR001005SANT/Myb domain
CDDcd001671.77E-1177120No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2577125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MRKPDLMANK DKMNNIKSKL RKGLWSPDED ERLVRYMLTN GQGCWSDIAR NAGLQRCGKS  60
CRLRWINYLR PDLKRGAFSP QEEDLIVHLH SILGNRWSQI AARLPGRTDN EIKNFWNSTL  120
KKRLKTNTST PSLNNSTGSS ESNKDVLSGI MPFNEHDIMT MCMDSSSSIS SMQAMVLPDQ  180
FDPFFMLANN QCDMTNVSSD FSNMPAACLT QIGMVDGHQG NYGILEPNKM GSGIDFSLPS  240
LESRSIESNS VPIDVKSHNN HFNYGSFKNT DKIQGSKVED LIGFGNHGQG ENLKMGEWDL  300
ENLMQDITSF PFLDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-272012425128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119125LKKRLKT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592969.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A0B2QHP30.0A0A0B2QHP3_GLYSO; Transcription factor MYB46
TrEMBLI1LVD90.0I1LVD9_SOYBN; Uncharacterized protein
STRINGGLYMA12G36630.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-79myb domain protein 83
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]